UNC50 Rabbit Polyclonal Antibody

CAT#: TA341928

Rabbit Polyclonal Anti-UNC50 Antibody

Product Images

WB Suggested Anti-UNC50 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UNC50 antibody: synthetic peptide directed towards the N terminal of human UNC50. Synthetic peptide located within the following region: LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: unc-50 inner nuclear membrane RNA binding protein
• Database Link:
  NP_054763
  Entrez Gene 25972 Human
  UniProt ID Q53HI1
• Background: May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA.
• Synonyms: GMH1; HSD23; PDLs22; UNCL; URP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane