Rabbit Polyclonal Anti-UPF3B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UPF3B antibody: synthetic peptide directed towards the N terminal of human UPF3B. Synthetic peptide located within the following region: MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL |
Rabbit Polyclonal Anti-UPF3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UPF3B antibody: synthetic peptide directed towards the middle region of human UPF3B. Synthetic peptide located within the following region: KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA |
UPF3B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human UPF3B (NP_075386.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
