UPF3B Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of UPF3 regulator of nonsense transcripts homolog B (yeast) (UPF3B), transcript variant 1
USD 605.00
Other products for "UPF3B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UPF3B antibody: synthetic peptide directed towards the middle region of human UPF3B. Synthetic peptide located within the following region: KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 58 kDa |
Gene Name | UPF3 regulator of nonsense transcripts homolog B (yeast) |
Database Link | |
Background | UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. |
Synonyms | HUPF3B; MRX62; MRXS14; RENT3B; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X; UPF3X |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Mouse: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.