Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-Upp2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Upp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG |
Carrier-free (BSA/glycerol-free) UPP2 mouse monoclonal antibody,clone OTI10A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPP2 mouse monoclonal antibody,clone OTI11F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPP2 mouse monoclonal antibody,clone OTI9G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UPP2 mouse monoclonal antibody,clone OTI10A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UPP2 mouse monoclonal antibody,clone OTI10A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UPP2 mouse monoclonal antibody,clone OTI10A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UPP2 mouse monoclonal antibody,clone OTI10A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UPP2 mouse monoclonal antibody,clone OTI11F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UPP2 mouse monoclonal antibody,clone OTI11F11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UPP2 mouse monoclonal antibody,clone OTI11F11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UPP2 mouse monoclonal antibody,clone OTI11F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UPP2 mouse monoclonal antibody,clone OTI9G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UPP2 mouse monoclonal antibody,clone OTI9G9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UPP2 mouse monoclonal antibody,clone OTI9G9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UPP2 mouse monoclonal antibody,clone OTI9G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- UPP2