Rabbit Polyclonal Anti-USP48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USP48 Antibody: synthetic peptide directed towards the middle region of human USP48. Synthetic peptide located within the following region: ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV |
Rabbit Polyclonal Anti-USP48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USP48 Antibody: synthetic peptide directed towards the C terminal of human USP48. Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS |
USP48 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human USP48 |
USP48 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human USP48 (NP_115612.4). |
| Modifications | Unmodified |
USP48 mouse monoclonal antibody,clone OTI1F10
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
