Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-UTP14A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UTP14A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-UTP14A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTP14A antibody: synthetic peptide directed towards the N terminal of human UTP14A. Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL |
UTP14A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UTP14A (NP_006640.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UTP14A