UTP14A Rabbit Polyclonal Antibody

CAT#: TA340128

Rabbit Polyclonal Anti-UTP14A Antibody

Product Images

WB Suggested Anti-UTP14A Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UTP14A antibody: synthetic peptide directed towards the N terminal of human UTP14A. Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88
• Gene Name: UTP14A small subunit processome component
• Database Link:
  NP_006640
  Entrez Gene 10813 Human
  UniProt ID Q9BVJ6
• Background: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
• Synonyms: dJ537K23.3; NYCO16; SDCCAG16
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 79%