Rabbit Polyclonal Anti-UBL4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBL4A antibody: synthetic peptide directed towards the middle region of human UBL4A. Synthetic peptide located within the following region: EGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRL |
Rabbit Polyclonal Anti-UBL4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBL4A antibody: synthetic peptide directed towards the C terminal of human UBL4A. Synthetic peptide located within the following region: SAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK |
Carrier-free (BSA/glycerol-free) UBL4A mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UBL4A Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
UBL4A mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UBL4A mouse monoclonal antibody, clone OTI3C12 (formerly 3C12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UBL4A mouse monoclonal antibody, clone OTI3C12 (formerly 3C12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBL4A mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
