UBL4A Rabbit Polyclonal Antibody

CAT#: TA342598

Rabbit Polyclonal Anti-UBL4A Antibody

Product Images

WB Suggested Anti-UBL4A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBL4A antibody: synthetic peptide directed towards the middle region of human UBL4A. Synthetic peptide located within the following region: EGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: ubiquitin like 4A
• Database Link:
  NP_055050
  Entrez Gene 8266 Human
  UniProt ID P11441
• Background: UBL4A is a component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. UBL4A is the TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
• Synonyms: DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Yeast: 83%

Reference Data

• Protein Families: Druggable Genome