Rabbit Polyclonal Anti-USP22 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP22 antibody: synthetic peptide directed towards the middle region of human USP22. Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE |
Mouse monoclonal USP22 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USP22 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP22 antibody: synthetic peptide directed towards the N terminal of human USP22. Synthetic peptide located within the following region: RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD |
USP22 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human USP22 |
| Modifications | Unmodified |
USP22 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of Human USP22. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
