USP22 Rabbit Polyclonal Antibody

CAT#: TA344368

Rabbit Polyclonal Anti-USP22 Antibody - middle region

Product Images

WB Suggested Anti-USP22 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: USP22; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: USP22; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: USP22; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP22 antibody: synthetic peptide directed towards the middle region of human USP22. Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: ubiquitin specific peptidase 22
• Database Link:
  NP_056091
  Entrez Gene 23326 Human
  UniProt ID Q9UPT9
• Background: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.
• Synonyms: USP3L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Protease