Rabbit Polyclonal Anti-UST Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UST antibody: synthetic peptide directed towards the C terminal of human UST. Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY |
Rabbit Polyclonal Anti-UST Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UST antibody: synthetic peptide directed towards the N terminal of human UST. Synthetic peptide located within the following region: PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL |
UST Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse UST |
Germany
Japan
United Kingdom
China
