uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody

CAT#: TA339020

Rabbit Polyclonal Anti-UST Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG0

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UST antibody: synthetic peptide directed towards the C terminal of human UST. Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: uronyl 2-sulfotransferase
• Database Link:
  NP_005706
  Entrez Gene 10090 Human
  UniProt ID Q9Y2C2
• Background: Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AB020316.1, AK292922.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: 2OST
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Chondroitin sulfate biosynthesis