Rabbit polyclonal anti-UTP14A antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UTP14A. |
Rabbit polyclonal anti-UTP14A antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UTP14A. |
Rabbit Polyclonal Anti-UTP14A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UTP14A antibody: synthetic peptide directed towards the N terminal of human UTP14A. Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL |
UTP14A Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UTP14A (NP_006640.2). |
Modifications | Unmodified |