Germany
Japan
United Kingdom
China
Antibodies
View as table Download
VGLL3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human VGLL3 |
Rabbit Polyclonal Anti-VGLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VGLL3 Antibody: synthetic peptide directed towards the middle region of human VGLL3. Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY |
Carrier-free (BSA/glycerol-free) VGLL3 mouse monoclonal antibody,clone OTI1C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VGLL3 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VGLL3 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
VGLL3 mouse monoclonal antibody,clone OTI1C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL3 mouse monoclonal antibody,clone OTI1C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
VGLL3 mouse monoclonal antibody,clone OTI1C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
VGLL3 mouse monoclonal antibody,clone OTI1C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
VGLL3 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL3 mouse monoclonal antibody,clone OTI1D8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
VGLL3 mouse monoclonal antibody,clone OTI1D8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
VGLL3 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL3 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL3 mouse monoclonal antibody,clone OTI4E6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
VGLL3 mouse monoclonal antibody,clone OTI4E6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
VGLL3 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- VGLL3