VGLL3 Rabbit Polyclonal Antibody

CAT#: TA333779

Rabbit Polyclonal Anti-VGLL3 Antibody

Product Images

WB Suggested Anti-VGLL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VGLL3 Antibody: synthetic peptide directed towards the middle region of human VGLL3. Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: vestigial like family member 3
• Database Link:
  NP_057290
  Entrez Gene 389136 Human
  UniProt ID A8MV65
• Background: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.
• Synonyms: VGL-3; VGL3
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 83%

Reference Data

• Protein Families: Transcription Factors