Antibodies

Jump to Filters
View as table Download
VIRMA Rabbit Polyclonal Antibody
TA383247

USD 275.00

3 Weeks

KIAA1429 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1700 of human KIAA1429 (NP_056311.2).
VIRMA Rabbit Polyclonal Antibody
TA383247S

USD 85.00

3 Weeks

KIAA1429 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1700 of human KIAA1429 (NP_056311.2).
VIRMA Rabbit Polyclonal Antibody
TA337384

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIAA1429 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KIAA1429 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA1429. Synthetic peptide located within the following region: FKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNE