Antibodies

Jump to Filters
View as table Download
VPS52 (C-term) Rabbit Polyclonal Antibody
AP54517PU-N

USD 450.00

2 Weeks

VPS52 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 613-641 amino acids from the C-terminal region of human VPS52
VPS52 Rabbit Polyclonal Antibody
TA344675

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPS52 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS52 antibody: synthetic peptide directed towards the middle region of human VPS52. Synthetic peptide located within the following region: RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF