VPS54 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-720 of human VPS54 (NP_001005739.1). |
| Modifications | Unmodified |
VPS54 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-720 of human VPS54 (NP_001005739.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VPS54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VPS54 Antibody: synthetic peptide directed towards the N terminal of human VPS54. Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR |
Rabbit Polyclonal Anti-VPS54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VPS54 Antibody: synthetic peptide directed towards the N terminal of human VPS54. Synthetic peptide located within the following region: FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS |
Germany
Japan
United Kingdom
China
