VPS54 Rabbit Polyclonal Antibody

CAT#: TA335554

Rabbit Polyclonal Anti-VPS54 Antibody

Product Images

WB Suggested Anti-VPS54 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VPS54 Antibody: synthetic peptide directed towards the N terminal of human VPS54. Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 107 kDa
• Gene Name: VPS54, GARP complex subunit
• Database Link:
  NP_057600
  Entrez Gene 51542 Human
  UniProt ID Q9P1Q0
• Background: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: HCC8; hVps54L; PPP1R164; SLP-8p; VPS54L; WR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%