Antibodies

Jump to Filters
View as table Download
VPS25 Rabbit Polyclonal Antibody
TA383255

USD 275.00

3 Weeks

VPS25 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1).
Modifications Unmodified
VPS25 Rabbit Polyclonal Antibody
TA383255S

USD 85.00

3 Weeks

VPS25 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1).
Modifications Unmodified
VPS25 Goat Polyclonal Antibody
TA303080

USD 375.00

In Stock

Goat Polyclonal Antibody against VPS25

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1.
VPS25 Rabbit Polyclonal Antibody
TA342975

USD 375.00

5 Days

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
VPS25 Rabbit Polyclonal Antibody
TA350606

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Vps25 Rabbit Polyclonal Antibody
TA363205

USD 360.00

5 Days

VPS25 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse VPS25
VPS25 Rabbit Polyclonal Antibody
TA365137

USD 380.00

4 Weeks

VPS25 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein