Antibodies

Jump to Filters
View as table Download
VPS26B Rabbit Polyclonal Antibody
TA316005

USD 345.00

4 Weeks

Rabbit polyclonal anti-VP26B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human VP26B.
VPS26B Rabbit Polyclonal Antibody
TA340216

USD 375.00

5 Days

Rabbit Polyclonal Anti-VPS26B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS26B antibody: synthetic peptide directed towards the C terminal of human VPS26B. Synthetic peptide located within the following region: AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR