Antibodies

Jump to Filters
View as table Download
VSIG8 Rabbit Polyclonal Antibody
TA336094

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
VSIG8 (C1orf204) (C-term) Rabbit Polyclonal Antibody
AP54521PU-N

USD 450.00

2 Weeks

VSIG8 (C1orf204) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 338-368 amino acids from the C-terminal region of human VSIG8
VSIG8 Rabbit Polyclonal Antibody
TA350603

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VSIG8
VSIG8 Rabbit Polyclonal Antibody
TA369456

USD 380.00

4 Weeks

VSIG8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VSIG8