Germany
Japan
United Kingdom
China
Antibodies
View as table Download
WDSUB1 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | AP8816c |
Rabbit Polyclonal Anti-WDSUB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: DGKELLNLTKESLADDLKIESLGLRSKVLRKIEELRTKVKSLSSGIPDEF |
Rabbit Polyclonal Anti-WDSUB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS |
WDSUB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WDSUB1 |
Active filters
Target Symbol
- WDSUB1