WDSUB1 Rabbit Polyclonal Antibody

CAT#: TA330512

Rabbit Polyclonal Anti-WDSUB1 Antibody

Product Images

WB Suggested Anti-WDSUB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: WD repeat, sterile alpha motif and U-box domain containing 1
• Database Link:
  NP_689741
  Entrez Gene 151525 Human
  UniProt ID Q8N9V3
• Background: WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown.
• Synonyms: UBOX6; WDSAM1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Goat: 83%

Reference Data

• Protein Families: Druggable Genome