Rabbit Polyclonal Anti-WBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP4 antibody: synthetic peptide directed towards the N terminal of human WBP4. Synthetic peptide located within the following region: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK |
Rabbit Polyclonal Anti-WBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP4 antibody: synthetic peptide directed towards the N terminal of human WBP4. Synthetic peptide located within the following region: NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG |
WBP4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-376 of human WBP4 (NP_009118.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
