WW domain binding protein 4 (WBP4) Rabbit Polyclonal Antibody

CAT#: TA340157

Rabbit Polyclonal Anti-WBP4 Antibody

Product Images

WB Suggested Anti-WBP4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WBP4 antibody: synthetic peptide directed towards the N terminal of human WBP4. Synthetic peptide located within the following region: NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: WW domain binding protein 4
• Database Link:
  NP_009118
  Entrez Gene 11193 Human
  UniProt ID O75554
• Background: This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A.
• Synonyms: FBP21
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%