Antibodies

Jump to Filters
View as table Download
WDR3 (N-term) Rabbit Polyclonal Antibody
AP54538PU-N

USD 450.00

2 Weeks

WDR3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 208-236 amino acids from the N-terminal region of human WDR3
WDR3 Rabbit Polyclonal Antibody
TA330338

USD 375.00

5 Days

Rabbit Polyclonal Anti-WDR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3. Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT