WDR3 Rabbit Polyclonal Antibody

CAT#: TA330338

Rabbit Polyclonal Anti-WDR3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "WDR3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3. Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 106 kDa
Gene Name WD repeat domain 3
Background WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Synonyms DIP2; UTP12
Note Immunogen sequence homology: Bovine: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 93%; African clawed frog: 92%; Chicken: 85%; Rat: 80%; Zebrafish: 78%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.