Antibodies

View as table Download

Exportin 5 (XPO5) Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 925-1204 of human Exportin 5 (Exportin 5 (XPO5)) (NP_065801.1).
Modifications Unmodified

Exportin 5 (XPO5) Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 925-1204 of human Exportin 5 (Exportin 5 (XPO5)) (NP_065801.1).
Modifications Unmodified

Rabbit Polyclonal Anti-XPO5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the middle region of human XPO5. Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE

Exportin 5 (XPO5) (1122-1152) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1122-1152 amino acids from the C-terminal region of Human Exportin-5.

Rabbit Polyclonal Anti-XPO5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the N terminal of human XPO5. Synthetic peptide located within the following region: LTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTL

Xpo5 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated