Exportin 5 (XPO5) Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 925-1204 of human Exportin 5 (Exportin 5 (XPO5)) (NP_065801.1). |
| Modifications | Unmodified |
Exportin 5 (XPO5) Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 925-1204 of human Exportin 5 (Exportin 5 (XPO5)) (NP_065801.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-XPO5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the middle region of human XPO5. Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE |
Exportin 5 (XPO5) (1122-1152) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1122-1152 amino acids from the C-terminal region of Human Exportin-5. |
Rabbit Polyclonal Anti-XPO5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the N terminal of human XPO5. Synthetic peptide located within the following region: LTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTL |
Xpo5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
