Exportin 5 (XPO5) Rabbit Polyclonal Antibody

CAT#: TA342467

Rabbit Polyclonal Anti-XPO5 Antibody

Product Images

WB Suggested Anti-XPO5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the N terminal of human XPO5. Synthetic peptide located within the following region: LTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 136 kDa
• Gene Name: exportin 5
• Database Link:
  NP_065801
  Entrez Gene 57510 Human
  UniProt ID Q9HAV4
• Background: This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process. [provided by RefSeq, Aug 2011]
• Synonyms: exp5
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Mouse: 85%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome