Exportin 5 (XPO5) Rabbit Polyclonal Antibody

CAT#: TA342467

Rabbit Polyclonal Anti-XPO5 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "XPO5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the N terminal of human XPO5. Synthetic peptide located within the following region: LTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 136 kDa
Gene Name exportin 5
Background This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process. [provided by RefSeq, Aug 2011]
Synonyms exp5
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Mouse: 85%; Horse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.