YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
Rabbit polyclonal anti-GAS41 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GAS41. |
Rabbit Polyclonal Anti-GAS41 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAS41 Antibody: A synthesized peptide derived from human GAS41 |
Rabbit Polyclonal anti-YEATS4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YEATS4 antibody: synthetic peptide directed towards the middle region of human YEATS4. Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET |
GAS41 (YEATS4) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Recombinant protein from human YEATS4 |
Rabbit Polyclonal anti-YEATS4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YEATS4 antibody: synthetic peptide directed towards the C terminal of human YEATS4. Synthetic peptide located within the following region: LTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC |
GAS41 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | synthesized peptide derived from human GAS41. AA range:1-50 |
Germany
Japan
United Kingdom
China
