Rabbit Polyclonal anti-YAF2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of human YAF2. Synthetic peptide located within the following region: KGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKK |
Rabbit Polyclonal Anti-YAF2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of mouse YAF2. Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE |
Rabbit Polyclonal Anti-YAF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of human YAF2. Synthetic peptide located within the following region: TQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVG |
Germany
Japan
United Kingdom
China
