Yaf2 Rabbit Polyclonal Antibody

CAT#: TA329928

Rabbit Polyclonal Anti-YAF2 Antibody

Product Images

WB Suggested Anti-YAF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of mouse YAF2. Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: YY1 associated factor 2
• Database Link:
  NP_077151
  Entrez Gene 67057 Mouse
  UniProt ID Q99LW6
• Background: Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling.
• Synonyms: MGC41856
• Note: Immunogen sequence homology: Mouse: 100%; Dog: 80%; Pig: 80%; Rat: 80%; Horse: 80%; Human: 80%; Bovine: 80%; Guinea pig: 80%