Germany
Japan
United Kingdom
China
Antibodies
View as table Download
YBX2 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal anti-YBOX2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YBOX2. |
Rabbit Polyclonal Anti-YBX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YBX2 Antibody: synthetic peptide directed towards the middle region of human YBX2. Synthetic peptide located within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP |
Rabbit Polyclonal Anti-YBX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YBX2 Antibody: synthetic peptide directed towards the N terminal of human YBX2. Synthetic peptide located within the following region: EPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQA |
USD 420.00
4 Weeks
Active filters
Target Symbol
- YBX2