Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZBTB33 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB33 antibody: synthetic peptide directed towards the N terminal of human ZBTB33. Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL |
Kaiso/ZBTB33 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1). |
| Modifications | Unmodified |
Kaiso/ZBTB33 Rabbit polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1). |
| Modifications | Unmodified |
Kaiso Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ZBTB33