Antibodies

View as table Download

ZBTB33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZBTB33

Rabbit Polyclonal Anti-ZBTB33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB33 antibody: synthetic peptide directed towards the N terminal of human ZBTB33. Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL

Kaiso/ZBTB33 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1).
Modifications Unmodified

Kaiso/ZBTB33 Rabbit polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1).
Modifications Unmodified

Kaiso Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated