Antibodies

View as table Download

Rabbit Polyclonal Anti-ZBTB43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB43 antibody: synthetic peptide directed towards the N terminal of human ZBTB43. Synthetic peptide located within the following region: EPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVL

Rabbit Polyclonal anti-ZNF297B antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF297B antibody: synthetic peptide directed towards the N terminal of human ZNF297B. Synthetic peptide located within the following region: LVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSS

Rabbit Polyclonal Anti-ZNF297B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF297B Antibody: synthetic peptide directed towards the middle region of human ZNF297B. Synthetic peptide located within the following region: QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSI

Zbtb43 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

ZBTB43 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZBTB43

ZBTB43 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZBTB43