ZBTB43 Rabbit Polyclonal Antibody

CAT#: TA331986

Rabbit Polyclonal Anti-ZNF297B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZBTB43"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF297B Antibody: synthetic peptide directed towards the middle region of human ZNF297B. Synthetic peptide located within the following region: QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name zinc finger and BTB domain containing 43
Background ZNF297B is a new candidate transcription factor
Synonyms ZBTB22B; ZNF-X; ZNF297B
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.