Rabbit Polyclonal Anti-ZBTB48 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the middle region of human ZBTB48. Synthetic peptide located within the following region: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG |
Rabbit Polyclonal Anti-ZBTB48 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the N terminal of human ZBTB48. Synthetic peptide located within the following region: EPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKL |
Rabbit Polyclonal Anti-ZBTB48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the N terminal of human ZBTB48. Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF |
ZBTB48 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ZBTB48 (NP_005332.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
