ZBTB48 Rabbit Polyclonal Antibody

CAT#: TA329704

Rabbit Polyclonal Anti-ZBTB48 Antibody

Product Images

WB Suggested Anti-ZBTB48 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: ZBTB48; Sample Tissue: 293T; Antibody Dilution: 1.0ug/ml; ZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the N terminal of human ZBTB48. Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: zinc finger and BTB domain containing 48
• Database Link:
  NP_005332
  Entrez Gene 3104 Human
  UniProt ID P10074
• Background: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.
• Synonyms: HKR3; pp9964; ZNF855
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors