Rabbit polyclonal TISB/ butyrate response factor 1 (Ser92) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TISB around the phosphorylation site of serine 92 (S-F-SP-E-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ZFP36L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP36L1 Antibody: synthetic peptide directed towards the N terminal of human ZFP36L1. Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG |
Rabbit Polyclonal Anti-ZFP36L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP36L1 Antibody: synthetic peptide directed towards the N terminal of human ZFP36L1. Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG |
Rabbit Polyclonal Anti-ZFP36L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP36L1 Antibody: synthetic peptide directed towards the N terminal of human ZFP36L1. Synthetic peptide located within the following region: QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY |
Rabbit Polyclonal Anti-ZFP36L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP36L1 antibody: synthetic peptide directed towards the middle region of human ZFP36L1. Synthetic peptide located within the following region: HMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSIS |
Carrier-free (BSA/glycerol-free) ZFP36L1 mouse monoclonal antibody,clone OTI4F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZFP36L1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human ZFP36L1 (NP_004917.2). |
| Modifications | Unmodified |
ZFP36L1 mouse monoclonal antibody,clone OTI4F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZFP36L1 mouse monoclonal antibody,clone OTI4F8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ZFP36L1 mouse monoclonal antibody,clone OTI4F8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZFP36L1 mouse monoclonal antibody,clone OTI4F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
