TIS11B (ZFP36L1) Rabbit Polyclonal Antibody

CAT#: TA333957

Rabbit Polyclonal Anti-ZFP36L1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZFP36L1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZFP36L1 Antibody: synthetic peptide directed towards the N terminal of human ZFP36L1. Synthetic peptide located within the following region: QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name ZFP36 ring finger protein-like 1
Background ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Synonyms Berg36; BRF1; cMG1; ERF-1; ERF1; RNF162B; TIS11B
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Pig: 100%; Guinea pig: 92%; Mouse: 92%; Rat: 92%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.