Antibodies

Jump to Filters
View as table Download
Zinc finger MIZ domain containing protein 1 (ZMIZ1) Rabbit Polyclonal Antibody
TA345286

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZMIZ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMIZ1 antibody: synthetic peptide directed towards the N terminal of human ZMIZ1. Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
Zinc finger MIZ domain containing protein 1 (ZMIZ1) Rabbit Polyclonal Antibody
TA319972

USD 430.00

5 Days

Rabbit Polyclonal ZIMP10 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ZIMP10 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ZIMP10.
Zinc finger MIZ domain containing protein 1 (ZMIZ1) Rabbit Polyclonal Antibody
TA356087

USD 360.00

5 Days

ZMIZ1 Antibody - N-terminal region (ARP32938_P050)

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1