Rabbit Polyclonal Anti-ZNF175 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the N terminal of human ZNF175. Synthetic peptide located within the following region: FSREEWQQLDPAQRCLYRDVMLELYSHLFAVGYHIPNPEVIFRMLKEKEP |
Rabbit Polyclonal Anti-ZNF175 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the C terminal of human ZNF175. Synthetic peptide located within the following region: QRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYKCSYSVKGFTKQ |
Rabbit Polyclonal Anti-ZNF175 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the N terminal of human ZNF175. Synthetic peptide located within the following region: MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC |
Carrier-free (BSA/glycerol-free) ZNF175 mouse monoclonal antibody,clone OTI1F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF175 mouse monoclonal antibody,clone OTI1F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF175 mouse monoclonal antibody,clone OTI1F2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF175 mouse monoclonal antibody,clone OTI1F2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF175 mouse monoclonal antibody,clone OTI1F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China