ZNF175 Rabbit Polyclonal Antibody

CAT#: TA339444

Rabbit Polyclonal Anti-ZNF175 Antibody

Product Images

WB Suggested Anti-ZNF175 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the N terminal of human ZNF175. Synthetic peptide located within the following region: MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: zinc finger protein 175
• Database Link:
  NP_009078
  Entrez Gene 7728 Human
  UniProt ID Q9Y473
• Background: ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection.
• Synonyms: OTK18
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors