Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ZNF18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF18. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZNF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF18 Antibody: synthetic peptide directed towards the N terminal of human ZNF18. Synthetic peptide located within the following region: DLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMS |
Rabbit Polyclonal Anti-Zkscan6 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Zkscan6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Zkscan6. Synthetic peptide located within the following region: FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC |
Rabbit Polyclonal Anti-ZNF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF18 antibody: synthetic peptide directed towards the middle region of human ZNF18. Synthetic peptide located within the following region: LSPQERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLP |
Carrier-free (BSA/glycerol-free) ZNF18 mouse monoclonal antibody,clone OTI4C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF18 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF18 mouse monoclonal antibody,clone OTI7A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF18 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF18 mouse monoclonal antibody,clone OTI4C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF18 mouse monoclonal antibody,clone OTI4C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF18 mouse monoclonal antibody,clone OTI4C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF18 mouse monoclonal antibody,clone OTI4C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF18 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF18 mouse monoclonal antibody,clone OTI2H4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF18 mouse monoclonal antibody,clone OTI2H4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF18 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF18 mouse monoclonal antibody,clone OTI7A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF18 mouse monoclonal antibody,clone OTI7A8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF18 mouse monoclonal antibody,clone OTI7A8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF18 mouse monoclonal antibody,clone OTI7A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF18 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF18 mouse monoclonal antibody,clone OTI2C1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF18 mouse monoclonal antibody,clone OTI2C1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF18 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ZNF18