ZNF18 Rabbit Polyclonal Antibody

CAT#: TA342497

Rabbit Polyclonal Anti-Zkscan6 Antibody

Product Images

Host: Rabbit; Target Name: Zkscan6; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Zkscan6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Zkscan6. Synthetic peptide located within the following region: FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger protein 18
• Database Link:
  NP_653281
  Entrez Gene 7566 Human
  UniProt ID P17022
• Background: May be involved in transcriptional regulation.
• Synonyms: HDSG1; KOX11; Zfp535; ZKSCAN6; ZNF535; ZSCAN38
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 83%

Reference Data

• Protein Families: Transcription Factors