Antibodies

Jump to Filters
View as table Download
ZNF180 (N-term) Rabbit Polyclonal Antibody
AP54662PU-N

USD 450.00

2 Weeks

ZNF180 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 106-136 amino acids from the N-terminal region of human ZN180
ZNF180 Rabbit Polyclonal Antibody
TA339457

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF180 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF180 antibody: synthetic peptide directed towards the middle region of human ZNF180. Synthetic peptide located within the following region: LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHS