ZNF180 Rabbit Polyclonal Antibody

CAT#: TA339457

Rabbit Polyclonal Anti-ZNF180 Antibody

Product Images

WB Suggested Anti-ZNF180 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 293T cell lysateZNF180 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF180 antibody: synthetic peptide directed towards the middle region of human ZNF180. Synthetic peptide located within the following region: LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: zinc finger protein 180
• Database Link:
  NP_037388
  Entrez Gene 7733 Human
  UniProt ID Q9UJW8
• Background: Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins. [supplied by OMIM, Jul 2002]. Transcript Variant: This variant (7) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon, compared to variant 1. This results in an isoform (5) with a shorter N-terminus, compared to isoform 1. Variants 5, 6, and 7 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB065087.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025090 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: HHZ168
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 91%; Dog: 79%; Horse: 77%

Reference Data

• Protein Families: Transcription Factors