Antibodies

View as table Download

ZNF185 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF185

Rabbit Polyclonal Anti-ZNF185 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF185 antibody: synthetic peptide directed towards the N terminal of human ZNF185. Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH

ZNF185 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF185